PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof013324
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 219aa    MW: 24574.1 Da    PI: 10.2735
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-1079133734PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-14107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++d+ + lG+g+W+ I++ + ++Rt+ q+ s+ qky
        Sof013324 107 PWTEEEHRKFLDGLRNLGKGDWRGISKGFVTTRTATQVASHAQKY 151
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.368100156IPR017930Myb domain
SuperFamilySSF466891.22E-17101157IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17103155IPR006447Myb domain, plants
SMARTSM007172.6E-9104154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-10105150IPR009057Homeodomain-like
CDDcd001672.37E-9107152No hitNo description
PfamPF002496.5E-12107151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
XDAWARSRGG IEGKGMEEEQ VRETTMTPVV LRLFGVDVRR GDGGEPEELP MDIKKSSSMP  60
NLIIHKPLLS PGDAGDGKGY ASDDAELASG QQKRRRRKAQ ERKKGIPWTE EEHRKFLDGL  120
RNLGKGDWRG ISKGFVTTRT ATQVASHAQK YFLRQNNPGK KKRRASLFDV GIADYNYNDD  180
QVPSPQRSIA TKPAPTQEII HTDRGDVPYR GFGEILRHX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19297KRRRRK
292103KRRRRKAQERKK
393103RRRRKAQERKK
4159163KKKRR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467479.11e-132hypothetical protein SORBIDRAFT_01g028870
SwissprotQ8S9H73e-33DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059Q0L71e-142A0A059Q0L7_9POAL; Uncharacterized protein
STRINGSb01g028870.11e-132(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-34MYB_related family protein